A novel murine β-defensin expressed in tongue, esophagus, and trachea*

Hong Peng Jia, Stephen A. Wowk, Brian C. Schutte, Sarah K. Lee, Andrea Vivado, Brian F. Tack, Charles L Bevins, Paul B. McCray

Research output: Contribution to journalArticle

61 Citations (Scopus)

Abstract

β-Defensins are broad spectrum antimicrobial peptides expressed at epithelial surfaces. Two human β-defensins, HBD-1 and HBD-2, have been identified. In the lung, HBD-2 is an inducible product of airway epithelia and may play a role in innate mucosal defenses. We recently characterized rat homologs (RBD-1, RBD-2) of the human genes and used these sequences to identify novel mouse genes. Mouse β-defensin-4 (MBD-4) was amplified from lung cDNA using polymerase chain reaction primers designed from conserved sequences of RBD-2 and HBD-2. A full-length cDNA was cloned which encodes a putative peptide with the sequence MRIHYLLFTFLLVLLSPLAAFTQIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIR. The peptide shares ~40% identity with HBD-2. MBD-4 mRNA was expressed in the esophagus, tongue, and trachea but not in any of 20 other tissues surveyed. Cloning of the genomic sequence of MBD-4 revealed two nearly (>99%) identical sequences encoding MBD-4 and the presence of numerous additional highly similar genomic sequences. Radiation hybrid mapping localized this gene to a region of chromosome 8 near several other defensins, MBD-2, MBD-3, and α-defensins (cryptdins) -3 and -17, consistent with a gene cluster. Our genomic cloning and mapping data suggest that there is a large β-defensin gene family in mice. Identification of murine β-defensins provides an opportunity to understand further the role of these peptides in host defense through animal model studies and the generation of β-defensin-deficient animals by gene targeting.

Original languageEnglish (US)
Pages (from-to)33314-33320
Number of pages7
JournalJournal of Biological Chemistry
Volume275
Issue number43
DOIs
StatePublished - Oct 27 2000
Externally publishedYes

Fingerprint

Defensins
Trachea
Tongue
Esophagus
Genes
Peptides
Cloning
Organism Cloning
Animals
Complementary DNA
Radiation Hybrid Mapping
Chromosomes, Human, Pair 8
Lung
Gene Targeting
Conserved Sequence
Polymerase chain reaction
Chromosomes
Multigene Family
Rats
Epithelium

ASJC Scopus subject areas

  • Biochemistry

Cite this

Jia, H. P., Wowk, S. A., Schutte, B. C., Lee, S. K., Vivado, A., Tack, B. F., ... McCray, P. B. (2000). A novel murine β-defensin expressed in tongue, esophagus, and trachea*. Journal of Biological Chemistry, 275(43), 33314-33320. https://doi.org/10.1074/jbc.M006603200

A novel murine β-defensin expressed in tongue, esophagus, and trachea*. / Jia, Hong Peng; Wowk, Stephen A.; Schutte, Brian C.; Lee, Sarah K.; Vivado, Andrea; Tack, Brian F.; Bevins, Charles L; McCray, Paul B.

In: Journal of Biological Chemistry, Vol. 275, No. 43, 27.10.2000, p. 33314-33320.

Research output: Contribution to journalArticle

Jia, HP, Wowk, SA, Schutte, BC, Lee, SK, Vivado, A, Tack, BF, Bevins, CL & McCray, PB 2000, 'A novel murine β-defensin expressed in tongue, esophagus, and trachea*', Journal of Biological Chemistry, vol. 275, no. 43, pp. 33314-33320. https://doi.org/10.1074/jbc.M006603200
Jia HP, Wowk SA, Schutte BC, Lee SK, Vivado A, Tack BF et al. A novel murine β-defensin expressed in tongue, esophagus, and trachea*. Journal of Biological Chemistry. 2000 Oct 27;275(43):33314-33320. https://doi.org/10.1074/jbc.M006603200
Jia, Hong Peng ; Wowk, Stephen A. ; Schutte, Brian C. ; Lee, Sarah K. ; Vivado, Andrea ; Tack, Brian F. ; Bevins, Charles L ; McCray, Paul B. / A novel murine β-defensin expressed in tongue, esophagus, and trachea*. In: Journal of Biological Chemistry. 2000 ; Vol. 275, No. 43. pp. 33314-33320.
@article{6de215793d8e446482eb8fecbdc53c32,
title = "A novel murine β-defensin expressed in tongue, esophagus, and trachea*",
abstract = "β-Defensins are broad spectrum antimicrobial peptides expressed at epithelial surfaces. Two human β-defensins, HBD-1 and HBD-2, have been identified. In the lung, HBD-2 is an inducible product of airway epithelia and may play a role in innate mucosal defenses. We recently characterized rat homologs (RBD-1, RBD-2) of the human genes and used these sequences to identify novel mouse genes. Mouse β-defensin-4 (MBD-4) was amplified from lung cDNA using polymerase chain reaction primers designed from conserved sequences of RBD-2 and HBD-2. A full-length cDNA was cloned which encodes a putative peptide with the sequence MRIHYLLFTFLLVLLSPLAAFTQIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIR. The peptide shares ~40{\%} identity with HBD-2. MBD-4 mRNA was expressed in the esophagus, tongue, and trachea but not in any of 20 other tissues surveyed. Cloning of the genomic sequence of MBD-4 revealed two nearly (>99{\%}) identical sequences encoding MBD-4 and the presence of numerous additional highly similar genomic sequences. Radiation hybrid mapping localized this gene to a region of chromosome 8 near several other defensins, MBD-2, MBD-3, and α-defensins (cryptdins) -3 and -17, consistent with a gene cluster. Our genomic cloning and mapping data suggest that there is a large β-defensin gene family in mice. Identification of murine β-defensins provides an opportunity to understand further the role of these peptides in host defense through animal model studies and the generation of β-defensin-deficient animals by gene targeting.",
author = "Jia, {Hong Peng} and Wowk, {Stephen A.} and Schutte, {Brian C.} and Lee, {Sarah K.} and Andrea Vivado and Tack, {Brian F.} and Bevins, {Charles L} and McCray, {Paul B.}",
year = "2000",
month = "10",
day = "27",
doi = "10.1074/jbc.M006603200",
language = "English (US)",
volume = "275",
pages = "33314--33320",
journal = "Journal of Biological Chemistry",
issn = "0021-9258",
publisher = "American Society for Biochemistry and Molecular Biology Inc.",
number = "43",

}

TY - JOUR

T1 - A novel murine β-defensin expressed in tongue, esophagus, and trachea*

AU - Jia, Hong Peng

AU - Wowk, Stephen A.

AU - Schutte, Brian C.

AU - Lee, Sarah K.

AU - Vivado, Andrea

AU - Tack, Brian F.

AU - Bevins, Charles L

AU - McCray, Paul B.

PY - 2000/10/27

Y1 - 2000/10/27

N2 - β-Defensins are broad spectrum antimicrobial peptides expressed at epithelial surfaces. Two human β-defensins, HBD-1 and HBD-2, have been identified. In the lung, HBD-2 is an inducible product of airway epithelia and may play a role in innate mucosal defenses. We recently characterized rat homologs (RBD-1, RBD-2) of the human genes and used these sequences to identify novel mouse genes. Mouse β-defensin-4 (MBD-4) was amplified from lung cDNA using polymerase chain reaction primers designed from conserved sequences of RBD-2 and HBD-2. A full-length cDNA was cloned which encodes a putative peptide with the sequence MRIHYLLFTFLLVLLSPLAAFTQIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIR. The peptide shares ~40% identity with HBD-2. MBD-4 mRNA was expressed in the esophagus, tongue, and trachea but not in any of 20 other tissues surveyed. Cloning of the genomic sequence of MBD-4 revealed two nearly (>99%) identical sequences encoding MBD-4 and the presence of numerous additional highly similar genomic sequences. Radiation hybrid mapping localized this gene to a region of chromosome 8 near several other defensins, MBD-2, MBD-3, and α-defensins (cryptdins) -3 and -17, consistent with a gene cluster. Our genomic cloning and mapping data suggest that there is a large β-defensin gene family in mice. Identification of murine β-defensins provides an opportunity to understand further the role of these peptides in host defense through animal model studies and the generation of β-defensin-deficient animals by gene targeting.

AB - β-Defensins are broad spectrum antimicrobial peptides expressed at epithelial surfaces. Two human β-defensins, HBD-1 and HBD-2, have been identified. In the lung, HBD-2 is an inducible product of airway epithelia and may play a role in innate mucosal defenses. We recently characterized rat homologs (RBD-1, RBD-2) of the human genes and used these sequences to identify novel mouse genes. Mouse β-defensin-4 (MBD-4) was amplified from lung cDNA using polymerase chain reaction primers designed from conserved sequences of RBD-2 and HBD-2. A full-length cDNA was cloned which encodes a putative peptide with the sequence MRIHYLLFTFLLVLLSPLAAFTQIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIR. The peptide shares ~40% identity with HBD-2. MBD-4 mRNA was expressed in the esophagus, tongue, and trachea but not in any of 20 other tissues surveyed. Cloning of the genomic sequence of MBD-4 revealed two nearly (>99%) identical sequences encoding MBD-4 and the presence of numerous additional highly similar genomic sequences. Radiation hybrid mapping localized this gene to a region of chromosome 8 near several other defensins, MBD-2, MBD-3, and α-defensins (cryptdins) -3 and -17, consistent with a gene cluster. Our genomic cloning and mapping data suggest that there is a large β-defensin gene family in mice. Identification of murine β-defensins provides an opportunity to understand further the role of these peptides in host defense through animal model studies and the generation of β-defensin-deficient animals by gene targeting.

UR - http://www.scopus.com/inward/record.url?scp=0034721859&partnerID=8YFLogxK

UR - http://www.scopus.com/inward/citedby.url?scp=0034721859&partnerID=8YFLogxK

U2 - 10.1074/jbc.M006603200

DO - 10.1074/jbc.M006603200

M3 - Article

C2 - 10922379

AN - SCOPUS:0034721859

VL - 275

SP - 33314

EP - 33320

JO - Journal of Biological Chemistry

JF - Journal of Biological Chemistry

SN - 0021-9258

IS - 43

ER -