Abstract
β-Defensins are broad spectrum antimicrobial peptides expressed at epithelial surfaces. Two human β-defensins, HBD-1 and HBD-2, have been identified. In the lung, HBD-2 is an inducible product of airway epithelia and may play a role in innate mucosal defenses. We recently characterized rat homologs (RBD-1, RBD-2) of the human genes and used these sequences to identify novel mouse genes. Mouse β-defensin-4 (MBD-4) was amplified from lung cDNA using polymerase chain reaction primers designed from conserved sequences of RBD-2 and HBD-2. A full-length cDNA was cloned which encodes a putative peptide with the sequence MRIHYLLFTFLLVLLSPLAAFTQIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIR. The peptide shares ~40% identity with HBD-2. MBD-4 mRNA was expressed in the esophagus, tongue, and trachea but not in any of 20 other tissues surveyed. Cloning of the genomic sequence of MBD-4 revealed two nearly (>99%) identical sequences encoding MBD-4 and the presence of numerous additional highly similar genomic sequences. Radiation hybrid mapping localized this gene to a region of chromosome 8 near several other defensins, MBD-2, MBD-3, and α-defensins (cryptdins) -3 and -17, consistent with a gene cluster. Our genomic cloning and mapping data suggest that there is a large β-defensin gene family in mice. Identification of murine β-defensins provides an opportunity to understand further the role of these peptides in host defense through animal model studies and the generation of β-defensin-deficient animals by gene targeting.
| Original language | English (US) |
|---|---|
| Pages (from-to) | 33314-33320 |
| Number of pages | 7 |
| Journal | Journal of Biological Chemistry |
| Volume | 275 |
| Issue number | 43 |
| DOIs | |
| State | Published - Oct 27 2000 |
| Externally published | Yes |
Fingerprint
ASJC Scopus subject areas
- Biochemistry
Cite this
A novel murine β-defensin expressed in tongue, esophagus, and trachea*. / Jia, Hong Peng; Wowk, Stephen A.; Schutte, Brian C.; Lee, Sarah K.; Vivado, Andrea; Tack, Brian F.; Bevins, Charles L; McCray, Paul B.
In: Journal of Biological Chemistry, Vol. 275, No. 43, 27.10.2000, p. 33314-33320.Research output: Contribution to journal › Article
}
TY - JOUR
T1 - A novel murine β-defensin expressed in tongue, esophagus, and trachea*
AU - Jia, Hong Peng
AU - Wowk, Stephen A.
AU - Schutte, Brian C.
AU - Lee, Sarah K.
AU - Vivado, Andrea
AU - Tack, Brian F.
AU - Bevins, Charles L
AU - McCray, Paul B.
PY - 2000/10/27
Y1 - 2000/10/27
N2 - β-Defensins are broad spectrum antimicrobial peptides expressed at epithelial surfaces. Two human β-defensins, HBD-1 and HBD-2, have been identified. In the lung, HBD-2 is an inducible product of airway epithelia and may play a role in innate mucosal defenses. We recently characterized rat homologs (RBD-1, RBD-2) of the human genes and used these sequences to identify novel mouse genes. Mouse β-defensin-4 (MBD-4) was amplified from lung cDNA using polymerase chain reaction primers designed from conserved sequences of RBD-2 and HBD-2. A full-length cDNA was cloned which encodes a putative peptide with the sequence MRIHYLLFTFLLVLLSPLAAFTQIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIR. The peptide shares ~40% identity with HBD-2. MBD-4 mRNA was expressed in the esophagus, tongue, and trachea but not in any of 20 other tissues surveyed. Cloning of the genomic sequence of MBD-4 revealed two nearly (>99%) identical sequences encoding MBD-4 and the presence of numerous additional highly similar genomic sequences. Radiation hybrid mapping localized this gene to a region of chromosome 8 near several other defensins, MBD-2, MBD-3, and α-defensins (cryptdins) -3 and -17, consistent with a gene cluster. Our genomic cloning and mapping data suggest that there is a large β-defensin gene family in mice. Identification of murine β-defensins provides an opportunity to understand further the role of these peptides in host defense through animal model studies and the generation of β-defensin-deficient animals by gene targeting.
AB - β-Defensins are broad spectrum antimicrobial peptides expressed at epithelial surfaces. Two human β-defensins, HBD-1 and HBD-2, have been identified. In the lung, HBD-2 is an inducible product of airway epithelia and may play a role in innate mucosal defenses. We recently characterized rat homologs (RBD-1, RBD-2) of the human genes and used these sequences to identify novel mouse genes. Mouse β-defensin-4 (MBD-4) was amplified from lung cDNA using polymerase chain reaction primers designed from conserved sequences of RBD-2 and HBD-2. A full-length cDNA was cloned which encodes a putative peptide with the sequence MRIHYLLFTFLLVLLSPLAAFTQIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIR. The peptide shares ~40% identity with HBD-2. MBD-4 mRNA was expressed in the esophagus, tongue, and trachea but not in any of 20 other tissues surveyed. Cloning of the genomic sequence of MBD-4 revealed two nearly (>99%) identical sequences encoding MBD-4 and the presence of numerous additional highly similar genomic sequences. Radiation hybrid mapping localized this gene to a region of chromosome 8 near several other defensins, MBD-2, MBD-3, and α-defensins (cryptdins) -3 and -17, consistent with a gene cluster. Our genomic cloning and mapping data suggest that there is a large β-defensin gene family in mice. Identification of murine β-defensins provides an opportunity to understand further the role of these peptides in host defense through animal model studies and the generation of β-defensin-deficient animals by gene targeting.
UR - http://www.scopus.com/inward/record.url?scp=0034721859&partnerID=8YFLogxK
UR - http://www.scopus.com/inward/citedby.url?scp=0034721859&partnerID=8YFLogxK
U2 - 10.1074/jbc.M006603200
DO - 10.1074/jbc.M006603200
M3 - Article
C2 - 10922379
AN - SCOPUS:0034721859
VL - 275
SP - 33314
EP - 33320
JO - Journal of Biological Chemistry
JF - Journal of Biological Chemistry
SN - 0021-9258
IS - 43
ER -